Checkout View cart “AngelX Application” has been added to your cart. 1 Personal Information 2 Professional Information 3 Payment Personal Information ABOUT YOU First Name *Last Name *Which City are you based out of? *Email Address *Phone Number *Designation *Company Name *Company Website *Your LinkedIn Profile *Your Twitter (optional)How did you hear about AngelX?* (optional) Friends & FamilyColleague Or A Professional ContactSocial MediaInc42 TeamGoogleOther job title *job seniority * What best describes you? *Have you invested in startups before? * Are you an accredited investor? What qualification(s) do you meet? * Why are you looking to invest in startups? * What value add do you bring to the table for founders? *Any accomplishments you’d like to highlight from your career?* *Why do you want to join the AngelX program? *Would you like to invite any of your friends/colleagues that might benefit from AngelX? *Great! How many startups have you invested in? *Can you share the names of some of the startups you’ve invested in? * Professional Information Ship to a different address? First name *Last name *Company name (optional)Country / Region *Select a country / region…AfghanistanÅland IslandsAlbaniaAlgeriaAmerican SamoaAndorraAngolaAnguillaAntarcticaAntigua and BarbudaArgentinaArmeniaArubaAustraliaAustriaAzerbaijanBahamasBahrainBangladeshBarbadosBelarusBelauBelgiumBelizeBeninBermudaBhutanBoliviaBonaire, Saint Eustatius and SabaBosnia and HerzegovinaBotswanaBouvet IslandBrazilBritish Indian Ocean TerritoryBruneiBulgariaBurkina FasoBurundiCambodiaCameroonCanadaCape VerdeCayman IslandsCentral African RepublicChadChileChinaChristmas IslandCocos (Keeling) IslandsColombiaComorosCongo (Brazzaville)Congo (Kinshasa)Cook IslandsCosta RicaCroatiaCubaCuraçaoCyprusCzech RepublicDenmarkDjiboutiDominicaDominican RepublicEcuadorEgyptEl SalvadorEquatorial GuineaEritreaEstoniaEswatiniEthiopiaFalkland IslandsFaroe IslandsFijiFinlandFranceFrench GuianaFrench PolynesiaFrench Southern TerritoriesGabonGambiaGeorgiaGermanyGhanaGibraltarGreeceGreenlandGrenadaGuadeloupeGuamGuatemalaGuernseyGuineaGuinea-BissauGuyanaHaitiHeard Island and McDonald IslandsHondurasHong KongHungaryIcelandIndiaIndonesiaIranIraqIrelandIsle of ManIsraelItalyIvory CoastJamaicaJapanJerseyJordanKazakhstanKenyaKiribatiKuwaitKyrgyzstanLaosLatviaLebanonLesothoLiberiaLibyaLiechtensteinLithuaniaLuxembourgMacaoMadagascarMalawiMalaysiaMaldivesMaliMaltaMarshall IslandsMartiniqueMauritaniaMauritiusMayotteMexicoMicronesiaMoldovaMonacoMongoliaMontenegroMontserratMoroccoMozambiqueMyanmarNamibiaNauruNepalNetherlandsNew CaledoniaNew ZealandNicaraguaNigerNigeriaNiueNorfolk IslandNorth KoreaNorth MacedoniaNorthern Mariana IslandsNorwayOmanPakistanPalestinian TerritoryPanamaPapua New GuineaParaguayPeruPhilippinesPitcairnPolandPortugalPuerto RicoQatarReunionRomaniaRussiaRwandaSão Tomé and PríncipeSaint BarthélemySaint HelenaSaint Kitts and NevisSaint LuciaSaint Martin (Dutch part)Saint Martin (French part)Saint Pierre and MiquelonSaint Vincent and the GrenadinesSamoaSan MarinoSaudi ArabiaSenegalSerbiaSeychellesSierra LeoneSingaporeSlovakiaSloveniaSolomon IslandsSomaliaSouth AfricaSouth Georgia/Sandwich IslandsSouth KoreaSouth SudanSpainSri LankaSudanSurinameSvalbard and Jan MayenSwedenSwitzerlandSyriaTaiwanTajikistanTanzaniaThailandTimor-LesteTogoTokelauTongaTrinidad and TobagoTunisiaTurkeyTurkmenistanTurks and Caicos IslandsTuvaluUgandaUkraineUnited Arab EmiratesUnited Kingdom (UK)United States (US)United States (US) Minor Outlying IslandsUruguayUzbekistanVanuatuVaticanVenezuelaVietnamVirgin Islands (British)Virgin Islands (US)Wallis and FutunaWestern SaharaYemenZambiaZimbabweUpdate country / regionStreet address *Apartment, suite, unit, etc. (optional)Town / City *State / County * Select an option…ANDAMAN And NICOBARANDHRA PRADESHARUNACHAL PRADESHASSAMBIHARCHANDIGARHCHATTISGARHDADRA AND NAGAR HAVELI AND DAMAN AND DIUDELHIGOAGUJRATHARYANAHIMACHAL PRADESHJAMMU And KASHMIRJHARKHANDKARNATAKAKERALALADAKHLAKSHDWEEPMADHYA PRADESHMAHARASHTRAMANIPURMEGHALAYAMIZORAMNAGALANDORISSAPONDICHERYPUNJABRAJASTHANSIKKIMTAMIL NADUTELANGANATRIPURAUTTAR PRADESHUTTARAKHANDWEST BENGALOTHER TERRITORYPostcode / ZIP * Additional information Tell Us About Your Professional Background? (Briefly In A Few Sentences) * Have You Invested In A Startup? *YesNo Link To Your Portfolio (AngelList, Website Link, etc) (optional) Are You Interested In Building An AIF? (Like Angel Or VC Fund) *YesNoNot Decided Yet What Industries/Sectors Do You Want To Invest In? * FinTech TravelTech Consumer Internet Retail IT Ecommerce EnterpriseTech EdTech HealthTech Web3 Logistics Agritech CleanTech Other What’s Your Domain Expertise? * Full-stack engineeringFront-end engineeringBack-end engineeringAI/ML/Data ScienceHardware/Electrical EngineeringDesignMarketingProduct DevelopmentProduct ManagementSalesGrowthFinanceC-Suite ExecutivesOperationsOther What Value Add Do You Bring For Startup Founders? * Any Accomplishments You’d Like To Highlight From Your Career? * Why Do You Want To Join AngelX? * Would You Like To Invite Any Of Your Friends/Colleagues To AngelX? Add Their Email Address Below. (optional) Payment COMPLETE APPLICATION Product Subtotal AngelX Application × 1 ₹0.00 Subtotal ₹0.00 Total ₹0.00 Since your browser does not support JavaScript, or it is disabled, please ensure you click the Update Totals button before placing your order. You may be charged more than the amount stated above if you fail to do so. Update totals Your personal data will be used to process your order, support your experience throughout this website, and for other purposes described in our privacy policy. Make Payment